Structure of PDB 4v88 Chain CW

Receptor sequence
>4v88CW (length=129) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
TRSSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFE
YIDDHRSGKIVVQLNGRLNKCGVISPRFNVKIGDIEKWTANLLPARQFGY
VILTTSAGIMDHEEARRKHVSGKILGFVY
3D structure
PDB4v88 The structure of the eukaryotic ribosome at 3.0 angstrom resolution.
ChainCW
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna CW T2 R3 S4 A8 D9 N12 N16 K19 K22 R28 S31 K32 H56 R57 S58 K71 V74 I75 S76 R78 N80 K82 W89 T105 T106 S107 R118 S122 K124 Y130 T1 R2 S3 A7 D8 N11 N15 K18 K21 R27 S30 K31 H55 R56 S57 K70 V73 I74 S75 R77 N79 K81 W88 T104 T105 S106 R117 S121 K123 Y129
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v88, PDBe:4v88, PDBj:4v88
PDBsum4v88
PubMed22096102
UniProtP0C0W1|RS22A_YEAST Small ribosomal subunit protein uS8A (Gene Name=RPS22A)

[Back to BioLiP]