Structure of PDB 4v7p Chain CW

Receptor sequence
>4v7pCW (length=76) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
TKNGRDSQAKRLGVKRYEGQVVRAGNILVRQRGTRFKPGKNVGMGRDFTL
FALVDGVVEFQDRGRLGRYVHVRPLA
3D structure
PDB4v7p Recognition of the amber UAG stop codon by release factor RF1.
ChainCW
Resolution3.62 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna CW N12 R14 D15 S16 A18 K19 R20 V23 K24 Y26 E27 Q29 A33 I36 R39 R41 T43 R44 F45 G54 R55 D56 F57 T58 F60 F69 L75 R77 N3 R5 D6 S7 A9 K10 R11 V14 K15 Y17 E18 Q20 A24 I27 R30 R32 T34 R35 F36 G45 R46 D47 F48 T49 F51 F60 L66 R68
BS02 rna CW R72 G73 R74 R63 G64 R65
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v7p, PDBe:4v7p, PDBj:4v7p
PDBsum4v7p
PubMed20588254
UniProtQ72HR3|RL27_THET2 Large ribosomal subunit protein bL27 (Gene Name=rpmA)

[Back to BioLiP]