Structure of PDB 6hhq Chain CV

Receptor sequence

>6hhqCV (length=159) Species: 4932 (Saccharomyces cerevisiae)

GKSHGYRSRTRYMFQRDFRKHGAVHLSTYLKVYKVGDIVDIKANGSIQKG
MPHKFYQGKTGVVYNVTKSSVGVIINKMVGNRYLEKRLNLRVEHIKHSKC
RQEFLERVKANAAKRAEAKAQGVAVQLKRQPAQPRESRIVSTEGNVPQTL
APVPYETFI

3D structure

• PDB: 6hhq Understanding the role of intermolecular interactions between lissoclimides and the eukaryotic ribosome.
• Chain: CV
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CV	G2 K3 S4 H5 G6 Y7 R8 S9 R10 R12 Y13 M14 Q16 R17 F19 H22 G23 D41 K43 G46 S47 Q49 K50 G51 H54 K55 Y57 Q58 G59 K60 T61 T68 K69 S70 S71 K78 K87 R88 N90 R92 K100 C101 R102 F105 R108 N112 R116 K120 Q127 L128 K129 R130	G1 K2 S3 H4 G5 Y6 R7 S8 R9 R11 Y12 M13 Q15 R16 F18 H21 G22 D40 K42 G45 S46 Q48 K49 G50 H53 K54 Y56 Q57 G58 K59 T60 T67 K68 S69 S70 K77 K86 R87 N89 R91 K99 C100 R101 F104 R107 N111 R115 K119 Q126 L127 K128 R129
BS02	rna	CV	H26 S28	H25 S27
BS03	OHX	CV	Y13 Q16 D18	Y12 Q15 D17
BS04	MG	CV	D41 G59	D40 G58

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6hhq, PDBe:6hhq, PDBj:6hhq
• PDBsum: 6hhq
• PubMed: 30759226
• UniProt: Q02753|RL21A_YEAST Large ribosomal subunit protein eL21A (Gene Name=RPL21A)