Structure of PDB 4v6w Chain CV

Receptor sequence
>4v6wCV (length=134) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
GGTAGGKFRISLGLPVGAVMNCADNTGAKNLYVIAVHGIRGRLNRLPAAG
VGDMFVATVKKGKPELRKKVMPAVVIRQRKPFRRRDGVFIYFEDNAGVIV
NNKGEMKGSAITGPVAKECADLWPRIASNASSIA
3D structure
PDB4v6w Structures of the human and Drosophila 80S ribosome.
ChainCV
Resolution6.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna CV G11 F14 R15 S17 G19 P21 A24 V25 I40 H43 R46 R48 L49 N50 R51 L52 K74 R85 K86 R89 F95 G5 F8 R9 S11 G13 P15 A18 V19 I34 H37 R40 R42 L43 N44 R45 L46 K68 R79 K80 R83 F89
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0017022 myosin binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0022626 cytosolic ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v6w, PDBe:4v6w, PDBj:4v6w
PDBsum4v6w
PubMed23636399
UniProtP48159|RL23_DROME Large ribosomal subunit protein uL14 (Gene Name=RpL23)

[Back to BioLiP]