Structure of PDB 4v9q Chain CU

Receptor sequence
>4v9qCU (length=100) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
RVKMHVKKGDTVLVASGKYKGRVGKVKEVLPKKYAVIVEGVNIVKKAVRV
SPKYPQGGFIEKEAPLHASKVRPICPACGKPTRVRKKFLENGKKIRVCAK
3D structure
PDB4v9q Blasticidin S inhibits translation by trapping deformed tRNA on the ribosome.
ChainCU
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna CU R2 V7 K9 S17 G18 K19 V30 P32 I44 K46 K47 V49 S52 P53 F60 H68 S70 K71 R73 R84 V85 R1 V6 K8 S16 G17 K18 V29 P31 I43 K45 K46 V48 S51 P52 F59 H67 S69 K70 R72 R83 V84
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v9q, PDBe:4v9q, PDBj:4v9q
PDBsum4v9q
PubMed23824292
UniProtQ72I15|RL24_THET2 Large ribosomal subunit protein uL24 (Gene Name=rplX)

[Back to BioLiP]