Structure of PDB 4v7e Chain CU

Receptor sequence

>4v7eCU (length=108) Species: 4565 (Triticum aestivum)

GGKKKGSVSFVIDCSKPVEDKIMEIASLEKFLQERIKVAGGKAGNLGDSV
TVTRDKTKVTVTSDGAFSKRYLKYLTKKYLKKHNVRDWLRVIAANKDRNV
YELRYFNI

3D structure

• PDB: 4v7e Structures of the Sec61 complex engaged in nascent peptide translocation or membrane insertion.
• Chain: CU
• Resolution: 5.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CU	K29 K50 V51 A56 L59 A79 F80 K82 R83 Y84 K86 Y87 L88 K90 K91 K94 K95 V104 I105 A106 N108 K109 R111 Y114	K16 K37 V38 A43 L46 A66 F67 K69 R70 Y71 K73 Y74 L75 K77 K78 K81 K82 V91 I92 A93 N95 K96 R98 Y101

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Mar 10 14:50:02 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v7e', asym_id = 'CU', title = 'Structures of the Sec61 complex engaged in nascent peptide translocation or membrane insertion.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v7e', asym_id='CU', title='Structures of the Sec61 complex engaged in nascent peptide translocation or membrane insertion.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4v7e', asym_id = 'CU'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4v7e', asym_id='CU')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>