Structure of PDB 8jiv Chain CT

Receptor sequence

>8jivCT (length=159) Species: 4565 (Triticum aestivum) [Search protein sequence]

PAGHGLRSRTRDLFARPFRKKGYIPLTTYLRTYKVGEHVDVKVNGAVHKG
MPHKFYHGRTGRVWNVTKRAIGVEINKQVGNRIIKKRIHVRVEHVQPSRC
NEEFLQRKLNNDKLKAEAKVRGEVISTKRQPAGPKPGFMVEGTTIETVTP
IPYDVVNDL

3D structure

PDB

8jiv Cryo-EM structure of wheat ribosome reveals unique features of the plant ribosomes.

Chain

Resolution

2.84 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CT	P2 A3 G4 H5 G6 R8 S9 R10 R12 D13 L14 A16 R17 F19 K22 G23 Y24 K35 D41 K43 G46 A47 H49 K50 G51 H54 K55 Y57 H58 G59 R60 T61 T68 R70 N77 K78 V80 N82 R83 I85 K87 R88 I89 H90 R92 R100 C101 E104 F105 R108 K109 N112 K116 S127 K129 R130 Q131	P1 A2 G3 H4 G5 R7 S8 R9 R11 D12 L13 A15 R16 F18 K21 G22 Y23 K34 D40 K42 G45 A46 H48 K49 G50 H53 K54 Y56 H57 G58 R59 T60 T67 R69 N76 K77 V79 N81 R82 I84 K86 R87 I88 H89 R91 R99 C100 E103 F104 R107 K108 N111 K115 S126 K128 R129 Q130
BS02	rna	CT	P26 L27 T28	P25 L26 T27

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8jiv, PDBe:8jiv, PDBj:8jiv
PDBsum	8jiv
PubMed	38458197
UniProt	F4YWL9

[Back to BioLiP]