Structure of PDB 6rxx Chain CT

Receptor sequence

>6rxxCT (length=131) Species: 209285 (Thermochaetoides thermophila)

ELSVRVPQLPGPPDTLSDWYNIPRTNLTPELKRDLQLLRMRDVVAMGKQF
FKKDNRKDFVPEYCQVGTIIAGATDGVSGRLTRKERKRTIVEEVLSSDSV
SKYKRKYHEIQEHKKSGRKGYYKKLMAARKR

3D structure

• PDB: 6rxx Thermophile 90S Pre-ribosome Structures Reveal the Reverse Order of Co-transcriptional 18S rRNA Subdomain Integration.
• Chain: CT
• Resolution: 7.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CT	M117 G118 K119 F121 F122 K124 S187 G188 R189 K190 G191 Y192 Y193 K194 K195 L196 M197 A198 A199 R200 K201	M46 G47 K48 F50 F51 K53 S116 G117 R118 K119 G120 Y121 Y122 K123 K124 L125 M126 A127 A128 R129 K130
BS02	rna	CT	T153 R154	T82 R83

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0006396 RNA processing

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus

External links

• PDB: RCSB:6rxx, PDBe:6rxx, PDBj:6rxx
• PDBsum: 6rxx
• PubMed: 31378463
• UniProt: G0S4E3