Structure of PDB 4wf1 Chain CT

Receptor sequence

>4wf1CT (length=85) Species: 83333 (Escherichia coli K-12)

NIKSAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKAAAQKAFN
EMQPIVDRQAAKGLIHKNKAARHKANLTAQINKLA

3D structure

• PDB: 4wf1 Negamycin induces translational stalling and miscoding by binding to the small subunit head domain of the Escherichia coli ribosome.
• Chain: CT
• Resolution: 3.09 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CT	N3 K5 A7 K9 R10 S14 K16 R18 H20 N21 A22 S23 R24 S26 M27 R29 T30 K33 K34 Q55 P56 D59 R60 K64 K69 N70 K71 A73 R74 H75 K76 A77 N78 T80	N1 K3 A5 K7 R8 S12 K14 R16 H18 N19 A20 S21 R22 S24 M25 R27 T28 K31 K32 Q53 P54 D57 R58 K62 K67 N68 K69 A71 R72 H73 K74 A75 N76 T78

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0008073 ornithine decarboxylase inhibitor activity
• GO:0019843 rRNA binding
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4wf1, PDBe:4wf1, PDBj:4wf1
• PDBsum: 4wf1
• PubMed: 25368144
• UniProt: P0A7U7|RS20_ECOLI Small ribosomal subunit protein bS20 (Gene Name=rpsT)