Structure of PDB 4v9k Chain CT

Receptor sequence

>4v9kCT (length=99) Species: 262724 (Thermus thermophilus HB27)

RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMR
KAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA

3D structure

• PDB: 4v9k Crystal structures of EF-G-ribosome complexes trapped in intermediate states of translocation.
• Chain: CT
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CT	L10 S11 K14 R15 H16 R17 S19 K21 R22 R23 N26 K29 S31 K34 T35 R57 E60 S61 D64 K65 K68 S70 K74 N75 R79 R80 K81 S82 R83 M85 G101 G102 G103 S105	L3 S4 K7 R8 H9 R10 S12 K14 R15 R16 N19 K22 S24 K27 T28 R50 E53 S54 D57 K58 K61 S63 K67 N68 R72 R73 K74 S75 R76 M78 G94 G95 G96 S98

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v9k, PDBe:4v9k, PDBj:4v9k
• PDBsum: 4v9k
• PubMed: 23812722
• UniProt: P62661|RS20_THET2 Small ribosomal subunit protein bS20 (Gene Name=rpsT)