Structure of PDB 4v7v Chain CT

Receptor sequence
>4v7vCT (length=85) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
NIKSAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKAAAQKAFN
EMQPIVDRQAAKGLIHKNKAARHKANLTAQINKLA
3D structure
PDB4v7v Structures of the Escherichia coli ribosome with antibiotics bound near the peptidyl transferase center explain spectra of drug action.
ChainCT
Resolution3.2891 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna CT N2 K4 S5 A6 K7 K8 R9 S13 R17 H19 N20 A21 S22 R24 S25 M26 T29 F30 K32 K33 Y35 Q54 D58 R59 K63 N69 K70 R73 H74 K75 A76 Q81 N1 K3 S4 A5 K6 K7 R8 S12 R16 H18 N19 A20 S21 R23 S24 M25 T28 F29 K31 K32 Y34 Q53 D57 R58 K62 N68 K69 R72 H73 K74 A75 Q80
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008073 ornithine decarboxylase inhibitor activity
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v7v, PDBe:4v7v, PDBj:4v7v
PDBsum4v7v
PubMed20876128
UniProtP0A7U7|RS20_ECOLI Small ribosomal subunit protein bS20 (Gene Name=rpsT)

[Back to BioLiP]