Structure of PDB 4v5r Chain CT

Receptor sequence
>4v5rCT (length=99) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMR
KAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
3D structure
PDB4v5r How Mutations in tRNA Distant from the Anticodon Affect the Fidelity of Decoding.
ChainCT
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna CT L10 K14 R15 R17 K21 R22 R23 A28 S31 T35 K39 R57 K58 E60 S61 D64 K65 K68 S70 N75 A78 R79 K81 S82 R83 M85 R89 G102 G103 S105 L3 K7 R8 R10 K14 R15 R16 A21 S24 T28 K32 R50 K51 E53 S54 D57 K58 K61 S63 N68 A71 R72 K74 S75 R76 M78 R82 G95 G96 S98
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v5r, PDBe:4v5r, PDBj:4v5r
PDBsum4v5r
PubMed21378964
UniProtP80380|RS20_THET8 Small ribosomal subunit protein bS20 (Gene Name=rpsT)

[Back to BioLiP]