Structure of PDB 4w29 Chain CS

Receptor sequence
>4w29CS (length=79) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
SLKKGVFVDDHLLEKVLELNAKGEKRLIKTWSRRSTIVPEMVGHTIAVYN
GKQHVPVYITENMVGHKLGEFAPTRTYRG
3D structure
PDB4w29 How the ribosome hands the A-site tRNA to the P site during EF-G-catalyzed translocation.
ChainCS
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna CS S4 L5 K6 F10 H14 K18 W34 R36 R37 Y52 G54 K55 K70 G72 E73 T77 R78 T79 Y80 G82 S1 L2 K3 F7 H11 K15 W31 R33 R34 Y49 G51 K52 K67 G69 E70 T74 R75 T76 Y77 G79
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4w29, PDBe:4w29, PDBj:4w29
PDBsum4w29
PubMed25190797
UniProtP62660|RS19_THET2 Small ribosomal subunit protein uS19 (Gene Name=rpsS)

[Back to BioLiP]