Structure of PDB 4v8i Chain CS

Receptor sequence
>4v8iCS (length=78) Species: 274 (Thermus thermophilus) [Search protein sequence]
KGVFVDDHLLEKVLELNAKGEKRLIKTWSRRSTIVPEMVGHTIAVYNGKQ
HVPVYITENMVGHKLGEFAPTRTYRGHG
3D structure
PDB4v8i How hibernation factors RMF, HPF, and YfiA turn off protein synthesis.
ChainCS
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna CS F10 H14 W34 R36 R37 Y52 N53 G54 K55 K70 G72 E73 T77 R78 T79 Y80 H83 F4 H8 W28 R30 R31 Y46 N47 G48 K49 K64 G66 E67 T71 R72 T73 Y74 H77
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v8i, PDBe:4v8i, PDBj:4v8i
PDBsum4v8i
PubMed22605777
UniProtQ5SHP2|RS19_THET8 Small ribosomal subunit protein uS19 (Gene Name=rpsS)

[Back to BioLiP]