Structure of PDB 4v7s Chain CS

Receptor sequence
>4v7sCS (length=79) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
RSLKKGPFIDLHLLKKVEKAVESGDKKPLRTWSRRSTIFPNMIGLTIAVH
NGRQHVPVFVTDEMVGHKLGEFAPTRTYR
3D structure
PDB4v7s Structures of the Escherichia coli ribosome with antibiotics bound near the peptidyl transferase center explain spectra of drug action.
ChainCS
Resolution3.2547 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna CS S3 L4 K5 K6 F9 H13 K17 W33 S34 R35 R36 H51 G53 R54 K69 G71 E72 T76 R77 T78 Y79 R80 S2 L3 K4 K5 F8 H12 K16 W32 S33 R34 R35 H50 G52 R53 K68 G70 E71 T75 R76 T77 Y78 R79
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v7s, PDBe:4v7s, PDBj:4v7s
PDBsum4v7s
PubMed20876128
UniProtP0A7U3|RS19_ECOLI Small ribosomal subunit protein uS19 (Gene Name=rpsS)

[Back to BioLiP]