Structure of PDB 4v6g Chain CS

Receptor sequence

>4v6gCS (length=84) Species: 300852 (Thermus thermophilus HB8)

MVKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLK
VDVERARYWLSVGAQPTDTARRLLRQAGVFRQEA

3D structure

• PDB: 4v6g Structural aspects of messenger RNA reading frame maintenance by the ribosome.
• Chain: CS
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CS	M1 K3 R5 L6 R8 G10 S11 K12 H13 Y17 D23 R25 R26 K27 R28 D29 K31 I33 Y38 P41 K43 T44 S61 V62 G63 T67 T69 R72 R75 F80 R81 Q82	M1 K3 R5 L6 R8 G10 S11 K12 H13 Y17 D23 R25 R26 K27 R28 D29 K31 I33 Y38 P41 K43 T44 S61 V62 G63 T67 T69 R72 R75 F80 R81 Q82

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Mar 10 11:09:22 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v6g', asym_id = 'CS', title = 'Structural aspects of messenger RNA reading frame maintenance by the ribosome.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v6g', asym_id='CS', title='Structural aspects of messenger RNA reading frame maintenance by the ribosome.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4v6g', asym_id = 'CS'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4v6g', asym_id='CS')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>