Structure of PDB 4u20 Chain CS

Receptor sequence
>4u20CS (length=79) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
RSLKKGPFIDLHLLKKVEKAVESGDKKPLRTWSRRSTIFPNMIGLTIAVH
NGRQHVPVFVTDEMVGHKLGEFAPTRTYR
3D structure
PDB4u20 Synergy of streptogramin antibiotics occurs independently of their effects on translation.
ChainCS
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna CS R3 S4 L5 K6 K7 H14 W34 R36 R37 H52 N53 G54 R55 K70 G72 E73 T77 R78 T79 Y80 R81 R1 S2 L3 K4 K5 H12 W32 R34 R35 H50 N51 G52 R53 K68 G70 E71 T75 R76 T77 Y78 R79
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4u20, PDBe:4u20, PDBj:4u20
PDBsum4u20
PubMed24957822
UniProtP0A7U3|RS19_ECOLI Small ribosomal subunit protein uS19 (Gene Name=rpsS)

[Back to BioLiP]