Structure of PDB 9bh5 Chain CR

Receptor sequence

>9bh5CR (length=194) Species: 6239 (Caenorhabditis elegans) [Search protein sequence]

SNLRLQKRLASAVLKCGKHRVWLDPNEVSEISGANSRQSIRRLVNDGLII
RKPVTVHSRFRAREYEEARRKGRHTGYGKRRGTANARMPEKTLWIRRMRV
LRNLLRRYRDAKKLDKHLYHELYLRAKGNNFKNKKNLIEYIFKKKTENKR
AKQLADQAQARRDKNKESRKRREERQVVKRAELLRKISQSEKVI

3D structure

PDB

9bh5 High-Resolution Reconstruction of a C. elegans Ribosome Sheds Light on Evolutionary Dynamics and Tissue Specificity.

Chain

Resolution

2.63 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CR	R173 R176	R172 R175
BS02	rna	CR	S2 N3 L4 R5 K8 R9 L10 K16 G18 K19 H20 R21 W23 L24 P26 S37 R38 R42 R52 T56 V57 H58 S59 R60 F61 R62 R64 R70 R74 H75 G77 Y78 G79 R81 R82 G83 T84 N86 A87 R88 M89 P90 K92 W95 I96 R100 R103 R108 R110 K117 H118 Y120 H121 Y124 L125 K128 G129 N130 N134 K135	S1 N2 L3 R4 K7 R8 L9 K15 G17 K18 H19 R20 W22 L23 P25 S36 R37 R41 R51 T55 V56 H57 S58 R59 F60 R61 R63 R69 R73 H74 G76 Y77 G78 R80 R81 G82 T83 N85 A86 R87 M88 P89 K91 W94 I95 R99 R102 R107 R109 K116 H117 Y119 H120 Y123 L124 K127 G128 N129 N133 K134

External links

PDB	RCSB:9bh5, PDBe:9bh5, PDBj:9bh5
PDBsum	9bh5
PubMed	39209556
UniProt	O02639\|RL19_CAEEL Large ribosomal subunit protein eL19 (Gene Name=rpl-19)

[Back to BioLiP]