Structure of PDB 8jiv Chain CR

Receptor sequence

>8jivCR (length=148) Species: 4565 (Triticum aestivum)

VSLKLQKRLASSVLKCGKGKVWLDPNEVNEISMANSRQNIRKLVKDGFII
RKPQKIHSRSRARRAHEAKQKGRHSGYGKRRGTREARLPTKILWMRRMRV
LRRLLRKYREAKKIDKHMYHDMYLKVKGNMFKNKRVLMESIHKSKAEK

3D structure

• PDB: 8jiv Cryo-EM structure of wheat ribosome reveals unique features of the plant ribosomes.
• Chain: CR
• Resolution: 2.84 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CR	S3 L4 K5 K8 R9 G18 K19 K21 W23 L24 S37 R38 R42 Q55 K56 I57 H58 S59 R60 S61 R62 R64 R65 H67 R74 H75 G77 Y78 G79 K80 R81 R82 G83 T84 R85 A87 R88 L89 P90 K92 I93 W95 M96 R100 V101 R103 R104 R110 K117 H118 Y120 H121 Y124 L125 K126 K128 G129 N130 N134 K135	S2 L3 K4 K7 R8 G17 K18 K20 W22 L23 S36 R37 R41 Q54 K55 I56 H57 S58 R59 S60 R61 R63 R64 H66 R73 H74 G76 Y77 G78 K79 R80 R81 G82 T83 R84 A86 R87 L88 P89 K91 I92 W94 M95 R99 V100 R102 R103 R109 K116 H117 Y119 H120 Y123 L124 K125 K127 G128 N129 N133 K134

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8jiv, PDBe:8jiv, PDBj:8jiv
• PDBsum: 8jiv
• PubMed: 38458197
• UniProt: A0A3B6C2W3