Structure of PDB 8i9v Chain CR

Receptor sequence

>8i9vCR (length=167) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]

RELQKRKRRSSRPTIRMPNRRKKALNPAGNNIIAKSWNKKETLSQNYTRF
GLVAKLGKATGGTAPGNKALLSESDAVPQQQQQENHIRQHDLELESKPEV
LRALEREATRPVEKTVRHQSEREREWLQRLVDKHGDDVAAMARDRKLNPY
QQTASDIKRRLKKAGLL

3D structure

PDB

8i9v Mechanism of 5S RNP recruitment and helicase-surveilled rRNA maturation during pre-60S biogenesis.

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CR	L5 Q6 K7 K9 R10 T16 I17 R18 M19 P20 R22 A30 T44 K60 T62 G63 G64 T65 N144 H145 R147 Q148 H149 R185 H186 S188 R190 E191 W194 Y218 Q220 T221 S223 R227 R228	L3 Q4 K5 K7 R8 T14 I15 R16 M17 P18 R20 A28 T42 K58 T60 G61 G62 T63 N85 H86 R88 Q89 H90 R117 H118 S120 R122 E123 W126 Y150 Q152 T153 S155 R159 R160
BS02	rna	CR	R3 R8 R10 R11 S12 S13 R14 P15 R22 K24	R1 R6 R8 R9 S10 S11 R12 P13 R20 K22

Gene Ontology

	Biological Process
GO:0042273	ribosomal large subunit biogenesis

	Cellular Component
GO:0005730	nucleolus

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8i9v, PDBe:8i9v, PDBj:8i9v
PDBsum	8i9v
PubMed	37129998
UniProt	G0S832

[Back to BioLiP]