Structure of PDB 6hhq Chain CR

Receptor sequence

>6hhqCR (length=183) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

ARYGATSTNPAKSASARGSYLRVSFKNTRETAQAINGWELTKAQKYLEQV
LDHQRAIPFRRFNSSIGRTAQGKEFGVTKARWPAKSVKFVQGLLQNAAAN
AEAKGLDATKLYVSHIQVNQAPKQRRRTYRAHGRINKYESSPSHIELVVT
EKEEAVAKAAEKKVVRLTSRQRGRIAAQKRIAA

3D structure

PDB

6hhq Understanding the role of intermolecular interactions between lissoclimides and the eukaryotic ribosome.

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CR	R3 Y4 S16 R18 Y21 R23 S25 F26 K27 N28 R30 Q34 Q55 R56 R62 F63 N64 S65 S66 I67 G68 R69 A71 Q72 K74 E75 T79 K80 R82 W83 P84 A85 K86 Q96 N97 A100 N101 Q118 V119 N120 Q121 K124 R127 T129 Y130 R131 A132 H133 G134 R135 I136 N137 K138 Y139 E140 S141 T169 S170 R171 Q172 R173 G174 R175 A178 R181	R2 Y3 S15 R17 Y20 R22 S24 F25 K26 N27 R29 Q33 Q54 R55 R61 F62 N63 S64 S65 I66 G67 R68 A70 Q71 K73 E74 T78 K79 R81 W82 P83 A84 K85 Q95 N96 A99 N100 Q117 V118 N119 Q120 K123 R126 T128 Y129 R130 A131 H132 G133 R134 I135 N136 K137 Y138 E139 S140 T168 S169 R170 Q171 R172 G173 R174 A177 R180
BS02	rna	CR	R3 Y4 G5 R61 R62 N120 Q121 P123 H145	R2 Y3 G4 R60 R61 N119 Q120 P122 H144

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000448	cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:0030687	preribosome, large subunit precursor
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6hhq, PDBe:6hhq, PDBj:6hhq
PDBsum	6hhq
PubMed	30759226
UniProt	P05740\|RL17A_YEAST Large ribosomal subunit protein uL22A (Gene Name=RPL17A)

[Back to BioLiP]