Structure of PDB 4w29 Chain CR

Receptor sequence
>4w29CR (length=70) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
KAKVKATLGEFDLRDYRNVEVLKRFLSETGKILPRRRTGLSAKEQRILAK
TIKRARILGLLPFTEKLVRK
3D structure
PDB4w29 How the ribosome hands the A-site tRNA to the P site during EF-G-catalyzed translocation.
ChainCR
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna CR K49 I50 P52 R54 S59 A60 K61 R64 K71 R72 R74 F81 T82 K31 I32 P34 R36 S41 A42 K43 R46 K53 R54 R56 F63 T64
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4w29, PDBe:4w29, PDBj:4w29
PDBsum4w29
PubMed25190797
UniProtP62659|RS18_THET2 Small ribosomal subunit protein bS18 (Gene Name=rpsR)

[Back to BioLiP]