Structure of PDB 4v88 Chain CR

Receptor sequence
>4v88CR (length=117) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
GRVRTKTVKRASKALIERYYPKLTLDFQTNKRLCDEIATIQSKRLRNKIA
GYTTHLMKRIQKGPVRGISFKLQEEERERKDQYVPEVSARSNGVLNVDNQ
TSDLVKSLGLKLPLSVI
3D structure
PDB4v88 The structure of the eukaryotic ribosome at 3.0 angstrom resolution.
ChainCR
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna CR G2 R3 V4 R5 T6 K7 T8 K10 R11 F28 K32 S43 K44 R45 L46 N48 K49 Y53 H56 K59 R60 R67 G1 R2 V3 R4 T5 K6 T7 K9 R10 F27 K31 S42 K43 R44 L45 N47 K48 Y52 H55 K58 R59 R66
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v88, PDBe:4v88, PDBj:4v88
PDBsum4v88
PubMed22096102
UniProtP02407|RS17A_YEAST Small ribosomal subunit protein eS17A (Gene Name=RPS17A)

[Back to BioLiP]