Structure of PDB 4v7e Chain CR

Receptor sequence

>4v7eCR (length=189) Species: 4565 (Triticum aestivum)

MVSLKLQKRLASSVLKCGKGKVWLDPNEVNEISMANSRQNIRKLVKDGFI
IRKPQKIHSRSRARRAHEAKQKGRHSGYGKRRGTREARLPTKILWMRRMR
VLRRLLRKYREAKKIDKHMYHDMYLKVKGNMFKNKRVLMESIHKSKAEKA
REKTLSDQFEAKRAKSKASRERKIARREERLAPGPERSC

3D structure

• PDB: 4v7e Structures of the Sec61 complex engaged in nascent peptide translocation or membrane insertion.
• Chain: CR
• Resolution: 5.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CR	F159 K162 R163 R170 K173 R176 R177 R180	F159 K162 R163 R170 K173 R176 R177 R180
BS02	rna	CR	M1 V2 L4 K5 L6 K8 R9 L10 G18 K19 K21 W23 L24 P26 N36 S37 R38 Q39 R42 K46 Q55 K56 I57 H58 S59 R60 R62 A63 R64 H67 K70 Q71 K72 R74 H75 Y78 G79 K80 R81 R82 G83 T84 R85 E86 A87 R88 K92 I93 W95 M96 R98 M99 R100 R103 R110 K114 K117 H118 Y120 H121 Y124 L125 K126 K128 G129 N130 M131 K135 R136 L138 M139 E140 S141 I142 H143 K144 K146 K149	M1 V2 L4 K5 L6 K8 R9 L10 G18 K19 K21 W23 L24 P26 N36 S37 R38 Q39 R42 K46 Q55 K56 I57 H58 S59 R60 R62 A63 R64 H67 K70 Q71 K72 R74 H75 Y78 G79 K80 R81 R82 G83 T84 R85 E86 A87 R88 K92 I93 W95 M96 R98 M99 R100 R103 R110 K114 K117 H118 Y120 H121 Y124 L125 K126 K128 G129 N130 M131 K135 R136 L138 M139 E140 S141 I142 H143 K144 K146 K149

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v7e, PDBe:4v7e, PDBj:4v7e
• PDBsum: 4v7e
• PubMed: 24499919
• UniProt: Q7XY20