Structure of PDB 4ujc Chain CR

Receptor sequence

>4ujcCR (length=109) Species: 9986 (Oryctolagus cuniculus)

GRVRTKTVKKAARVIIEKYYTRLGNDFHTNKRVCEEIAIIPSKKLRNKIA
GYVTHLMKRIQRGPVRGISIKLQEEERERRDNYVPEPDTKEMLKLLDFGS
LSNLQVTQP

3D structure

• PDB: 4ujc Structure of the Mammalian 80S Initiation Complex with Initiation Factor 5B on Hcv-Ires RNA.
• Chain: CR
• Resolution: 9.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CR	G2 R3 V4 R5 T6 K7 K10 F28 K32 S43 K45 L46 N48 K49 G52 Y53 H56 K59 R60	G1 R2 V3 R4 T5 K6 K9 F27 K31 S42 K44 L45 N47 K48 G51 Y52 H55 K58 R59

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Mar 7 10:01:53 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4ujc', asym_id = 'CR', title = 'Structure of the Mammalian 80S Initiation Complex with Initiation Factor 5B on Hcv-Ires RNA.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4ujc', asym_id='CR', title='Structure of the Mammalian 80S Initiation Complex with Initiation Factor 5B on Hcv-Ires RNA.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4ujc', asym_id = 'CR'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4ujc', asym_id='CR')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>