Structure of PDB 6xu7 Chain CQ

Receptor sequence

>6xu7CQ (length=187) Species: 7227 (Drosophila melanogaster)

GIDINHKYDRKVRRTEPKSQDVYLRLLVKLYRFLQRRTNKKFNRIILKRL
FMSKINRPPLSLQRIARFFKAANQPESTIVVVGTVTDDARLLVVPKLTVC
ALHVTQTARERILKAGGEVLTFDQLALRSPTGKNTLLLQGRRTARTACKH
FGKAPGVPHSHTRPYVRSKGRKFERARGRRSSCGYKK

3D structure

• PDB: 6xu7 Ribosome heterogeneity in Drosophila melanogaster gonads through paralog-switching.
• Chain: CQ
• Resolution: 4.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CQ	G2 K8 D10 R11 K12 V13 R14 R15 K19 S20 K30 F34 R37 R38 N40 K41 K42 R45 K49 M53 S54 K55 P60 S62 Q64 R65 R68 A72 Q75 T87 D88 D89 R91 H104 T106 T108 G133 K134 N135 Q140 G141 R142 R143 T144 A145 R146 A148 F152 G157 R164 Y166 V167 R168 K173 R180 R181 S182 S183 C184 G185 Y186	G1 K7 D9 R10 K11 V12 R13 R14 K18 S19 K29 F33 R36 R37 N39 K40 K41 R44 K48 M52 S53 K54 P59 S61 Q63 R64 R67 A71 Q74 T86 D87 D88 R90 H103 T105 T107 G132 K133 N134 Q139 G140 R141 R142 T143 A144 R145 A147 F151 G156 R163 Y165 V166 R167 K172 R179 R180 S181 S182 C183 G184 Y185

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0022626 cytosolic ribosome
• GO:0043232 intracellular non-membrane-bounded organelle
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6xu7, PDBe:6xu7, PDBj:6xu7
• PDBsum: 6xu7
• PubMed: 34283226
• UniProt: Q9VS34|RL18_DROME Large ribosomal subunit protein eL18 (Gene Name=RpL18)