Structure of PDB 6hiy Chain CQ

Receptor sequence

>6hiyCQ (length=190) Species: 5702 (Trypanosoma brucei brucei)

PWWNFQTEHRQRCVLMYGGARTKNTHNANHRVFIKKYKRNAFPNRTRHHW
AVSMTGVLSQRPRRMPWPYDLTSLIFNQPRQGSDKIGYVVGTSMLKTAVV
ATNHMVYYPKFNQRVSRTKRFFAHDEDLACVEGDLVHIKQCRKISKYKHY
YVFSILEPNVEGRERLKLGLKAVPPPLFGYPVSRRIVKLN

3D structure

• PDB: 6hiy Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
• Chain: CQ
• Resolution: 3.27 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CQ	P10 Q15 T16 H18 R19 R21 C22 K32 N33 T34 H35 N36 A37 H39 R40 K44 K45 K47 R48 N49 P52 N53 R54 T55 R56 H57 H58 W59 S62 M63 T64 G65 V66 L67 S68 Q69 R70 R73 P75 R89 S102 M103 L104 K105 T106 H113 K119 R126 T127 K128 R129 Q149 K152 S154 K155 Y156 K157 H158 Y159 G188 Y189 P190 S192 R193	P1 Q6 T7 H9 R10 R12 C13 K23 N24 T25 H26 N27 A28 H30 R31 K35 K36 K38 R39 N40 P43 N44 R45 T46 R47 H48 H49 W50 S53 M54 T55 G56 V57 L58 S59 Q60 R61 R64 P66 R80 S93 M94 L95 K96 T97 H104 K110 R117 T118 K119 R120 Q140 K143 S145 K146 Y147 K148 H149 Y150 G179 Y180 P181 S183 R184

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0000314 organellar small ribosomal subunit
• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005763 mitochondrial small ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6hiy, PDBe:6hiy, PDBj:6hiy
• PDBsum: 6hiy
• PubMed: 30213880
• UniProt: Q38DP8