Structure of PDB 5tbw Chain CQ

Receptor sequence

>5tbwCQ (length=197) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

VEPVVVIDGKGHLVGRLASVVAKQLLNGQKIVVVRAEELNISGEFFRNKL
KYHDFLRKATAFNKTRGPFHFRAPSRIFYKALRGMVSHKTARGKAALERL
KVFEGIPPPYDKKKRVVVPQALRVLRLKPGRKYTTLGKLSTSVGWKYEDV
VAKLEAKRKVSSAEYYAKKRAFTKKVASANATAAESDVAKQLAALGY

3D structure

PDB

5tbw Synthesis facilitates an understanding of the structural basis for translation inhibition by the lissoclimides.

Chain

Resolution

3.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	CQ	E4 P5 V6 G17 R18 S21 K25 K32 R37 S44 F48 R49 R59 K60 A61 T62 A63 F64 N65 K66 R68 P70 F71 H72 F73 R74 K82 A83 R85 G86 M87 K91 T92 A93 R94 K96 A97 R101 F105 G107 I108 P109 P110 K114 K115 K116 R117 Q122 R128 K130 P131 R133 K134 S144 G146 K148 Y149 L156 E157 K159 R160 K161 S164 Y167 Y168 K171 R172 K176	E2 P3 V4 G15 R16 S19 K23 K30 R35 S42 F46 R47 R57 K58 A59 T60 A61 F62 N63 K64 R66 P68 F69 H70 F71 R72 K80 A81 R83 G84 M85 K89 T90 A91 R92 K94 A95 R99 F103 G105 I106 P107 P108 K112 K113 K114 R115 Q120 R126 K128 P129 R131 K132 S142 G144 K146 Y147 L154 E155 K157 R158 K159 S162 Y165 Y166 K169 R170 K174
BS02	MG	CQ	L28 R94	L26 R92
BS03	MG	CQ	P110 P111	P108 P109

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000470	maturation of LSU-rRNA
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0017148	negative regulation of translation

	Cellular Component
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5tbw, PDBe:5tbw, PDBj:5tbw
PDBsum	5tbw
PubMed	29064494
UniProt	P26784\|RL16A_YEAST Large ribosomal subunit protein uL13A (Gene Name=RPL16A)

[Back to BioLiP]