Structure of PDB 4v9q Chain CQ

Receptor sequence

>4v9qCQ (length=117) Species: 262724 (Thermus thermophilus HB27)

PRAKTGVVRRRKHKKILKLAKGYWGLRSKSFRKARETLFAAGNYAYAHRK
RRKRDFRRLWIVRINAACRQHGLNYSTFIHGLKKAGIEVDRKNLADLAVR
EPQVFAELVERAKAAQG

3D structure

• PDB: 4v9q Blasticidin S inhibits translation by trapping deformed tRNA on the ribosome.
• Chain: CQ
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CQ	P2 R3 A4 K5 T6 V8 R10 R11 R12 K13 H14 K15 K16 K19 G23 Y24 W25 G26 L27 R28 S31 F32 R33 K34 E37 A42 Y45 A46 Y47 H49 R50 K51 R52 R53 K54 R55 F57 R59 W61 N66 R70 N75 Y76 S77 H81 R92 K93	P1 R2 A3 K4 T5 V7 R9 R10 R11 K12 H13 K14 K15 K18 G22 Y23 W24 G25 L26 R27 S30 F31 R32 K33 E36 A41 Y44 A45 Y46 H48 R49 K50 R51 R52 K53 R54 F56 R58 W60 N65 R69 N74 Y75 S76 H80 R91 K92
BS02	MG	CQ	S77 T78	S76 T77
BS03	MG	CQ	W25 L27 R28	W24 L26 R27
BS04	MG	CQ	R50 K51	R49 K50
BS05	MG	CQ	R55 R59	R54 R58

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v9q, PDBe:4v9q, PDBj:4v9q
• PDBsum: 4v9q
• PubMed: 23824292
• UniProt: Q72L76|RL20_THET2 Large ribosomal subunit protein bL20 (Gene Name=rplT)