Structure of PDB 4v88 Chain CQ

Receptor sequence

>4v88CQ (length=142) Species: 559292 (Saccharomyces cerevisiae S288C)

SAVPSVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVEPEILRFKVYEP
LLLVGLDKFSNIDIRVRVTGGGHVSQVYAIRQAIAKGLVAYHQKYVDEQS
KNELKKAFTSYDRTLLIADSRRPEPKKFGGKGARSRFQKSYR

3D structure

• PDB: 4v88 The structure of the eukaryotic ribosome at 3.0 angstrom resolution.
• Chain: CQ
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CQ	Q8 F10 K12 K13 K14 S15 V19 K26 K30 R66 G71 G72 G73 H74 V75 Q77 S121 R122 R123 P124 E125 P126 K127 K128 F129 K132 R135 S136 R137 F138 Q139 K140 Y142 R143	Q7 F9 K11 K12 K13 S14 V18 K25 K29 R65 G70 G71 G72 H73 V74 Q76 S120 R121 R122 P123 E124 P125 K126 K127 F128 K131 R134 S135 R136 F137 Q138 K139 Y141 R142

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006412 translation
• GO:0006413 translational initiation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:0030686 90S preribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v88, PDBe:4v88, PDBj:4v88
• PDBsum: 4v88
• PubMed: 22096102
• UniProt: P0CX51|RS16A_YEAST Small ribosomal subunit protein uS9A (Gene Name=RPS16A)