Structure of PDB 8jiv Chain CP

Receptor sequence

>8jivCP (length=153) Species: 4565 (Triticum aestivum) [Search protein sequence]

VKYSTDPANPTKSAKAMGRDLRVHFKNTRETAFALRKMSLNKAKRYLEDV
LAHKQAIPFRRYCRGVGRTAQVKNRQPNGQGRWPAKSAKFVLDLLKNAES
NAEVKGLDVDALYISHIQVNQAQKQRRRTYRAHGRINPYMSNPCHIELIL
SEK

3D structure

PDB

8jiv Cryo-EM structure of wheat ribosome reveals unique features of the plant ribosomes.

Chain

Resolution

2.84 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CP	Y4 K16 M18 R23 H25 F26 K27 R30 K43 R46 R62 Y63 R65 G66 G68 R69 A71 K74 N75 P78 Q81 R83 W84 P85 A86 K87 N98 S101 N102 Q119 V120 K125 R128 R129 T130 Y131 R132 A133 H134 G135 I137 N138 P139 Y140 M141 S142	Y3 K15 M17 R22 H24 F25 K26 R29 K42 R45 R61 Y62 R64 G65 G67 R68 A70 K73 N74 P77 Q80 R82 W83 P84 A85 K86 N97 S100 N101 Q118 V119 K124 R127 R128 T129 Y130 R131 A132 H133 G134 I136 N137 P138 Y139 M140 S141
BS02	rna	CP	K3 S5 R61 N121 Q122 Q124 H146	K2 S4 R60 N120 Q121 Q123 H145

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8jiv, PDBe:8jiv, PDBj:8jiv
PDBsum	8jiv
PubMed	38458197
UniProt	W5FSM8

[Back to BioLiP]