Structure of PDB 6xu8 Chain CP

Receptor sequence

>6xu8CP (length=185) Species: 7227 (Drosophila melanogaster)

GRYSRESDNVAKSCKARGPNLRVHFKNTHETAQAIKRMPLRRAQRYLKAV
IDQKECVPFRRFNGGVGRCAQAKQWKTTQGRWPKKSAEFLLQLLRNAEAN
ADCKGLDADRLVVHHIQVNRAQCLRRRTYRAHGRINPYMSSPCHVEVILT
EKEELVSKATDDEPAKKKLSKKKLQRQKEKMLRSE

3D structure

• PDB: 6xu8 Ribosome heterogeneity in Drosophila melanogaster gonads through paralog-switching.
• Chain: CP
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CP	S5 R38 R61 N120 Q123	S4 R37 R60 N119 Q122
BS02	rna	CP	R3 Y4 K16 A17 R18 P20 R23 H25 K27 N28 H30 Q34 R43 Y47 R62 N64 G65 G66 G68 R69 A71 Q72 K74 Q75 K77 Q80 R82 W83 K85 K86 Q93 R96 N97 A100 N101 C104 H116 Q118 V119 R127 T129 Y130 R131 A132 H133 G134 R135 N137 P138 Y139 M140 S141 K168 R177 Q178 K179 K181 M182 R184 S185	R2 Y3 K15 A16 R17 P19 R22 H24 K26 N27 H29 Q33 R42 Y46 R61 N63 G64 G65 G67 R68 A70 Q71 K73 Q74 K76 Q79 R81 W82 K84 K85 Q92 R95 N96 A99 N100 C103 H115 Q117 V118 R126 T128 Y129 R130 A131 H132 G133 R134 N136 P137 Y138 M139 S140 K167 R176 Q177 K178 K180 M181 R183 S184

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:0022626 cytosolic ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6xu8, PDBe:6xu8, PDBj:6xu8
• PDBsum: 6xu8
• PubMed: 34283226
• UniProt: Q9W3W8|RL17_DROME Large ribosomal subunit protein uL22 (Gene Name=RpL17)