Structure of PDB 4w29 Chain CP

Receptor sequence
>4w29CP (length=84) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
MVKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLK
VDVERARYWLSVGAQPTDTARRLLRQAGVFRQEA
3D structure
PDB4w29 How the ribosome hands the A-site tRNA to the P site during EF-G-catalyzed translocation.
ChainCP
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna CP M1 F9 G10 S11 K12 H13 H16 R18 D23 R25 D29 G30 K31 I33 Y38 P41 R42 K43 T44 T45 T67 D68 T69 R72 R75 R81 Q82 E83 A84 M1 F9 G10 S11 K12 H13 H16 R18 D23 R25 D29 G30 K31 I33 Y38 P41 R42 K43 T44 T45 T67 D68 T69 R72 R75 R81 Q82 E83 A84
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4w29, PDBe:4w29, PDBj:4w29
PDBsum4w29
PubMed25190797
UniProtP62238|RS16_THET2 Small ribosomal subunit protein bS16 (Gene Name=rpsP)

[Back to BioLiP]