Structure of PDB 4v6a Chain CP

Receptor sequence

>4v6aCP (length=83) Species: 300852 (Thermus thermophilus HB8)

MVKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLK
VDVERARYWLSVGAQPTDTARRLLRQAGVFRQE

3D structure

• PDB: 4v6a Formation of the first peptide bond: the structure of EF-P bound to the 70S ribosome.
• Chain: CP
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CP	M1 K3 R5 L6 R8 F9 G10 S11 K12 H13 H16 Y17 R18 A24 R25 R26 K27 R28 G30 K31 K35 Y38 P41 R42 K43 T44 W59 S61 V62 G63 T67 T69 R72 R81 Q82	M1 K3 R5 L6 R8 F9 G10 S11 K12 H13 H16 Y17 R18 A24 R25 R26 K27 R28 G30 K31 K35 Y38 P41 R42 K43 T44 W59 S61 V62 G63 T67 T69 R72 R81 Q82

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v6a, PDBe:4v6a, PDBj:4v6a
• PDBsum: 4v6a
• PubMed: 19696344
• UniProt: Q5SJH3|RS16_THET8 Small ribosomal subunit protein bS16 (Gene Name=rpsP)