Structure of PDB 4ujd Chain CP

Receptor sequence

>4ujdCP (length=118) Species: 9986 (Oryctolagus cuniculus)

FRKFTYRGVDLDQLLDMSYEQLMQLYSARQRRRLNRGLRRKQHSLLKRLR
KAKKEAPPMEKPEVVKTHLRDMIILPEMVGSMVGVYNGKTFNQVEIKPEM
IGHYLGEFSITYKPVKHG

3D structure

• PDB: 4ujd Structure of the Mammalian 80S Initiation Complex with Eif5B on Hcv Ires
• Chain: CP
• Resolution: 8.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CP	S38 A39 R40 R42 R43 R44 R47 K52 K77 T78 H79 R81 D82 Y97 N98 G99 K100 F102 Y115 E118 Y123 K124 V126 K127 H128 G129	S27 A28 R29 R31 R32 R33 R36 K41 K66 T67 H68 R70 D71 Y86 N87 G88 K89 F91 Y104 E107 Y112 K113 V115 K116 H117 G118

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Mar 7 08:51:50 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4ujd', asym_id = 'CP', title = 'Structure of the Mammalian 80S Initiation Complex with Eif5B on Hcv Ires'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4ujd', asym_id='CP', title='Structure of the Mammalian 80S Initiation Complex with Eif5B on Hcv Ires')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003723,0003735,0005840,0006412,0015935', uniprot = '', pdbid = '4ujd', asym_id = 'CP'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003735,0005840,0006412,0015935', uniprot='', pdbid='4ujd', asym_id='CP')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>