Structure of PDB 4u1v Chain CP

Receptor sequence
>4u1vCP (length=82) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
MVTIRLARHGAKKRPFYQVVVADSRNARNGRFIERVGFFNPIASEKEEGT
RLDLDRIAHWVGQGATISDRVAALIKEVNKAA
3D structure
PDB4u1v Synergy of streptogramin antibiotics occurs independently of their effects on translation.
ChainCP
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna CP M1 T3 R5 L6 R8 H9 G10 K12 K13 R14 F16 Y17 R25 R28 N29 G30 R31 R35 Q63 G64 S68 R70 M1 T3 R5 L6 R8 H9 G10 K12 K13 R14 F16 Y17 R25 R28 N29 G30 R31 R35 Q63 G64 S68 R70
Gene Ontology
Molecular Function
GO:0000400 four-way junction DNA binding
GO:0003735 structural constituent of ribosome
GO:0004519 endonuclease activity
GO:0004520 DNA endonuclease activity
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006259 DNA metabolic process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4u1v, PDBe:4u1v, PDBj:4u1v
PDBsum4u1v
PubMed24957822
UniProtP0A7T3|RS16_ECOLI Small ribosomal subunit protein bS16 (Gene Name=rpsP)

[Back to BioLiP]