Structure of PDB 9cai Chain CO

Receptor sequence

>9caiCO (length=201) Species: 6239 (Caenorhabditis elegans) [Search protein sequence]

GLSNRAIIIDGKNHLLGRLASIVAKKLLQGDKVVVLRAEEIVISGNFHRS
KLKYMSFLRKRCNINPARGAFHYRAPGKIFWRTVRGMLPHKTNRGNEALK
NLRAYEGVPAKYQKTKSLHAPSASRFRLQPRRKFCVVGRLSHEVGWQFQD
VVAKLEAKRKVKGAAYFEQKKKMDKLAVQAKKNAAPKIAQYQKIIEALGY
N

3D structure

PDB

9cai High-Resolution Reconstruction of a C. elegans Ribosome Sheds Light on Evolutionary Dynamics and Tissue Specificity.

Chain

Resolution

2.59 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CO	R6 K13 G18 R19 S22 K26 L29 R38 S45 H49 R50 L53 K54 S57 R60 K61 R62 C63 N64 N66 P67 R69 A71 F72 H73 Y74 R75 R83 T84 R86 G87 M88 H91 K92 R95 N97 K101 R104 G108 V109 Q114 K115 T116 K117 F127 R128 L129 Q130 R133 E144 V145 G146 Q148 L156 E157 K163 A165 Y167 F168 K171 K172	R5 K12 G17 R18 S21 K25 L28 R37 S44 H48 R49 L52 K53 S56 R59 K60 R61 C62 N63 N65 P66 R68 A70 F71 H72 Y73 R74 R82 T83 R85 G86 M87 H90 K91 R94 N96 K100 R103 G107 V108 Q113 K114 T115 K116 F126 R127 L128 Q129 R132 E143 V144 G145 Q147 L155 E156 K162 A164 Y166 F167 K170 K171

External links

PDB	RCSB:9cai, PDBe:9cai, PDBj:9cai
PDBsum	9cai
PubMed	39209556
UniProt	Q27389\|RL13A_CAEEL Large ribosomal subunit protein uL13 (Gene Name=rpl-16)

[Back to BioLiP]