Structure of PDB 8jiv Chain CO

Receptor sequence

>8jivCO (length=205) Species: 4565 (Triticum aestivum) [Search protein sequence]

VSGSGVCAKRVVVDARHHMLGRLASIVAKELLNGQRVVVVRCEEICMSGG
LVRQKMKYLRFLRKRMNTKPSHGPIHFRAPAKILWRTIRGMIPHKTARGE
AALARLKAYEGVPPPYDRTKRMVIPDALKVLRLQPGHRYCLLGQLSKEVG
WNYADTIRELEEKRKEKAKVSYDRRKQLAKLRVKAEKAAEEKLGTQLEIL
APIKY

3D structure

PDB

8jiv Cryo-EM structure of wheat ribosome reveals unique features of the plant ribosomes.

Chain

Resolution

2.84 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CO	V2 R17 G22 R23 S26 K30 R42 S49 R54 K58 R61 R64 K65 R66 M67 N68 K70 P71 H73 G74 P75 I76 H77 F78 R79 R87 T88 R90 M92 P94 A98 R99 V113 P114 P115 R119 T120 R122 D127 V131 L132 R133 L134 Q135 H138 V150 N153 Y154 L161 K164 K166 K168 S172 Y173 R176 R183 Y206	V1 R16 G21 R22 S25 K29 R41 S48 R53 K57 R60 R63 K64 R65 M66 N67 K69 P70 H72 G73 P74 I75 H76 F77 R78 R86 T87 R89 M91 P93 A97 R98 V112 P113 P114 R118 T119 R121 D126 V130 L131 R132 L133 Q134 H137 V149 N152 Y153 L160 K163 K165 K167 S171 Y172 R175 R182 Y205

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0017148	negative regulation of translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8jiv, PDBe:8jiv, PDBj:8jiv
PDBsum	8jiv
PubMed	38458197
UniProt	Q5I7L1

[Back to BioLiP]