Structure of PDB 4w2g Chain CO

Receptor sequence

>4w2gCO (length=88) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHH
SHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG

3D structure

PDB

4w2g Amicoumacin a inhibits translation by stabilizing mRNA interaction with the ribosome.

Chain

Resolution

2.55 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CO	P2 K8 F18 D21 T22 G23 S24 Q28 L31 R35 L39 H42 H46 K48 D49 H50 H51 S52 R54 G55 M58 M59 Q62 R65 R68 Y69 R72	P1 K7 F17 D20 T21 G22 S23 Q27 L30 R34 L38 H41 H45 K47 D48 H49 H50 S51 R53 G54 M57 M58 Q61 R64 R67 Y68 R71
BS02	rna	CO	S40 H53 L56 V60 G89	S39 H52 L55 V59 G88

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4w2g, PDBe:4w2g, PDBj:4w2g
PDBsum	4w2g
PubMed	25306919
UniProt	Q5SJ76\|RS15_THET8 Small ribosomal subunit protein uS15 (Gene Name=rpsO)