Structure of PDB 4v8e Chain CO

Receptor sequence

>4v8eCO (length=150) Species: 300852 (Thermus thermophilus HB8)

MKLSDLRPNPGANKRRKRVGRGPGSGHGKTATRGHKGQKSRSGGLKDPRR
FEGGRSTTLMRLPKRGMQGQVPGEIKRPRYQGVNLKDLARFEGEVTPELL
VRAGLLKKGYRLKILGEGEAKPLKVVAHAFSKSALEKLKAAGGEPVLLEA

3D structure

• PDB: 4v8e A new understanding of the decoding principle on the ribosome.
• Chain: CO
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CO	S4 R7 N9 A12 N13 K14 R16 K17 R18 V19 R21 G22 P23 G24 G28 K29 T30 T32 R33 G34 K36 G37 Q38 K39 S40 R41 S42 L45 K46 D47 P48 R50 G53 G54 R55 S56 L59 M60 R61 P63 K64 R65 G66 M67 G69 Q70 V71 P72 G73 E74 I75 R77 N84 G104 L105 K108 K113 L115 G116 E117 S131 K132 S133 A150	S4 R7 N9 A12 N13 K14 R16 K17 R18 V19 R21 G22 P23 G24 G28 K29 T30 T32 R33 G34 K36 G37 Q38 K39 S40 R41 S42 L45 K46 D47 P48 R50 G53 G54 R55 S56 L59 M60 R61 P63 K64 R65 G66 M67 G69 Q70 V71 P72 G73 E74 I75 R77 N84 G104 L105 K108 K113 L115 G116 E117 S131 K132 S133 A150
BS02	OHX	CO	P72 E74	P72 E74

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v8e, PDBe:4v8e, PDBj:4v8e
• PDBsum: 4v8e
• PubMed: 22437501
• UniProt: Q5SHQ7|RL15_THET8 Large ribosomal subunit protein uL15 (Gene Name=rplO)