Structure of PDB 4v8c Chain CO

Receptor sequence

>4v8cCO (length=125) Species: 300852 (Thermus thermophilus HB8)

PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRK
VAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGV
YDAAGVKDRKKSRSKYGTKKPKEAA

3D structure

• PDB: 4v8c A new understanding of the decoding principle on the ribosome.
• Chain: CO
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CO	P2 T3 N5 Q6 R9 R12 E13 G26 P28 F29 R30 R31 K43 K44 N46 S47 L49 R50 K51 Y66 P68 G69 E70 L81 G84 R86 V87 K88 D89 P91 R94 R110 K111 K112 S113 R114 S115 K116 T119 K120 K121	P1 T2 N4 Q5 R8 R11 E12 G25 P27 F28 R29 R30 K42 K43 N45 S46 L48 R49 K50 Y65 P67 G68 E69 L80 G83 R85 V86 K87 D88 P90 R93 R109 K110 K111 S112 R113 S114 K115 T118 K119 K120
BS02	MG	CO	P45 N46	P44 N45

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v8c, PDBe:4v8c, PDBj:4v8c
• PDBsum: 4v8c
• PubMed: 22437501
• UniProt: Q5SHN3|RS12_THET8 Small ribosomal subunit protein uS12 (Gene Name=rpsL)