Structure of PDB 4v5c Chain CO

Receptor sequence
>4v5cCO (length=88) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHH
SHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
3D structure
PDB4v5c Insights Into Substrate Stabilization from Snapshots of the Peptidyl Transferase Center of the Intact 70S Ribosome
ChainCO
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna CO P2 K5 K8 Q9 F18 D21 T22 G23 S24 Q28 L31 R35 L39 H42 H46 K48 D49 H51 S52 R54 G55 M58 Q62 R65 Y69 R72 P1 K4 K7 Q8 F17 D20 T21 G22 S23 Q27 L30 R34 L38 H41 H45 K47 D48 H50 S51 R53 G54 M57 Q61 R64 Y68 R71
BS02 rna CO S40 H53 L56 V60 G89 S39 H52 L55 V59 G88
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v5c, PDBe:4v5c, PDBj:4v5c
PDBsum4v5c
PubMed19363482
UniProtQ5SJ76|RS15_THET8 Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]