Structure of PDB 4v50 Chain CO

Receptor sequence
>4v50CO (length=88) Species: 562 (Escherichia coli) [Search protein sequence]
SLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHH
SRRGLLRMVSQRRKLLDYLKRKDVARYTRLIERLGLRR
3D structure
PDB4v50 Structural basis for mRNA and tRNA positioning on the ribosome.
ChainCO
Resolution3.22 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna CO S1 T4 T7 D20 T21 G22 S23 Q27 L30 H41 H45 K47 D48 H50 S51 R53 G54 M58 K64 Y68 R71 K72 S1 T4 T7 D20 T21 G22 S23 Q27 L30 H41 H45 K47 D48 H50 S51 R53 G54 M58 K64 Y68 R71 K72
BS02 rna CO Q39 L55 R88 Q39 L55 R88
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v50, PDBe:4v50, PDBj:4v50
PDBsum4v50
PubMed17038497
UniProtQ8X9M2|RS15_ECO57 Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]