Structure of PDB 1vy6 Chain CO

Receptor sequence
>1vy6CO (length=88) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHH
SHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
3D structure
PDB1vy6 A proton wire to couple aminoacyl-tRNA accommodation and peptide-bond formation on the ribosome.
ChainCO
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna CO P2 K8 F18 T22 G23 S24 Q28 R35 H42 H46 K48 D49 H50 H51 S52 R54 M58 M59 G61 R65 R68 Y69 P1 K7 F17 T21 G22 S23 Q27 R34 H41 H45 K47 D48 H49 H50 S51 R53 M57 M58 G60 R64 R67 Y68
BS02 rna CO S40 K44 H53 L56 V60 R64 S39 K43 H52 L55 V59 R63
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1vy6, PDBe:1vy6, PDBj:1vy6
PDBsum1vy6
PubMed25132179
UniProtQ5SJ76|RS15_THET8 Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]