Structure of PDB 9bh5 Chain CN

Receptor sequence

>9bh5CN (length=203) Species: 6239 (Caenorhabditis elegans) [Search protein sequence]

GAYKYMQEIWRKKQSDALRYLLRIRTWHYRQLSAVHRVPRPTRPEKARRL
GYRAKQGFVVYRVRVRRGNRKRPVCKGQTYGKPKTHGVNELKNAKSKQAV
AEGRAGRRLGSLRVLNSYWVAEDSTYKFYEVVLIDPFHKAIRRNPDTQWI
TKPVHKHREQRGLTSAGRKSRGLGKGWRFSATRGGSQAKNWKRKNTKVFH
RKR

3D structure

PDB

9bh5 High-Resolution Reconstruction of a C. elegans Ribosome Sheds Light on Evolutionary Dynamics and Tissue Specificity.

Chain

Resolution

2.63 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CN	R38 Q57 V60 Y62 R109 L110 S112 D136 H139	R37 Q56 V59 Y61 R108 L109 S111 D135 H138
BS02	rna	CN	G2 Y4 Q8 R12 K14 Q15 R24 W28 R31 H37 P40 R44 K47 R49 R50 R54 A55 K56 Q57 R65 R67 R68 G69 N70 R71 K72 P74 V75 C76 K77 G78 Q79 Y81 G82 K83 P84 K85 H87 V89 N90 E91 K93 N94 A95 K96 S97 K98 R105 R108 S112 W120 S125 Y127 K128 F138 K140 R144 W150 K157 H158 Q161 R162 S166 R169 K170 S171 R172 K176 G177 W178 R179 R184 G185 G186 S187 Q188 K190 W192 R194 K195 H201 R204	G1 Y3 Q7 R11 K13 Q14 R23 W27 R30 H36 P39 R43 K46 R48 R49 R53 A54 K55 Q56 R64 R66 R67 G68 N69 R70 K71 P73 V74 C75 K76 G77 Q78 Y80 G81 K82 P83 K84 H86 V88 N89 E90 K92 N93 A94 K95 S96 K97 R104 R107 S111 W119 S124 Y126 K127 F137 K139 R143 W149 K156 H157 Q160 R161 S165 R168 K169 S170 R171 K175 G176 W177 R178 R183 G184 G185 S186 Q187 K189 W191 R193 K194 H200 R203

External links

PDB	RCSB:9bh5, PDBe:9bh5, PDBj:9bh5
PDBsum	9bh5
PubMed	39209556
UniProt	P91374\|RL15_CAEEL Large ribosomal subunit protein eL15 (Gene Name=rpl-15)

[Back to BioLiP]