Structure of PDB 8k82 Chain CN

Receptor sequence
>8k82CN (length=112) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
SQRKLQQDIDKLLKKVKEGIEDFDDIYEKFQSTDPSNSSHREKLESDLKR
EIKKLQKHRDQIKTWLSKEDVKDKQSVLMTNRRLIENGMERFKSVEKLMK
TKQFSKEALTNP
3D structure
PDB8k82 Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
ChainCN
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna CN S40 K44 F105 S39 K43 F104
BS02 rna CN Q57 R60 K69 E87 M90 E91 E97 K101 K103 Q104 F105 S106 K107 Q56 R59 K68 E86 M89 E90 E96 K100 K102 Q103 F104 S105 K106
BS03 rna CN R4 Q8 K54 K55 R3 Q7 K53 K54
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0000289 nuclear-transcribed mRNA poly(A) tail shortening
GO:0000290 deadenylation-dependent decapping of nuclear-transcribed mRNA
GO:0006368 transcription elongation by RNA polymerase II
GO:0016567 protein ubiquitination
GO:0031087 deadenylation-independent decapping of nuclear-transcribed mRNA
GO:0032968 positive regulation of transcription elongation by RNA polymerase II
Cellular Component
GO:0000932 P-body
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0030015 CCR4-NOT core complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8k82, PDBe:8k82, PDBj:8k82
PDBsum8k82
PubMed38942792
UniProtQ12514|NOT5_YEAST General negative regulator of transcription subunit 5 (Gene Name=NOT5)

[Back to BioLiP]