Structure of PDB 6xu8 Chain CN

Receptor sequence

>6xu8CN (length=203) Species: 7227 (Drosophila melanogaster) [Search protein sequence]

GAYRYMQELYRKKQSDVMRYLLRIRVWQYRQLTKLHRSPRPTRPDKARRL
GYRAKQGFVIYRIRVRRGGRKRPVPKGCTYGKPKSHGVNQLKPYRGLQSI
AEERVGRRLGGLRVLNSYWIAQDASYKYFEVILIDTHHSAIRRDPKINWI
CKHVHKHRELRGLTSAGKSSRGIGKGYRYSQTIGGSRRAAWKRKNREHMH
RKR

3D structure

PDB

6xu8 Ribosome heterogeneity in Drosophila melanogaster gonads through paralog-switching.

Chain

Resolution

3.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CN	R38 Q57 Y62 R109 L110 L113 D136 H139	R37 Q56 Y61 R108 L109 L112 D135 H138
BS02	rna	CN	G2 Y4 R5 Q8 R12 K14 Q15 R24 W28 T34 K35 H37 P40 K47 R49 R50 L51 R54 A55 Q57 R67 R68 G69 G70 R71 K72 R73 P74 P76 K77 Y81 G82 K83 K85 H87 N90 Q91 L92 K93 P94 Y95 R96 G97 L98 E104 R105 R108 Y119 W120 D124 A125 H138 S140 A141 R143 R144 K147 W150 H154 V155 K157 H158 R162 G163 S166 K169 S170 S171 R172 I174 K176 G177 Y178 R179 S181 Q182 I184 G185 S187 R188 R189 W192 K193 R194 K195 R197 H199 M200 H201 R202 K203 R204	G1 Y3 R4 Q7 R11 K13 Q14 R23 W27 T33 K34 H36 P39 K46 R48 R49 L50 R53 A54 Q56 R66 R67 G68 G69 R70 K71 R72 P73 P75 K76 Y80 G81 K82 K84 H86 N89 Q90 L91 K92 P93 Y94 R95 G96 L97 E103 R104 R107 Y118 W119 D123 A124 H137 S139 A140 R142 R143 K146 W149 H153 V154 K156 H157 R161 G162 S165 K168 S169 S170 R171 I173 K175 G176 Y177 R178 S180 Q181 I183 G184 S186 R187 R188 W191 K192 R193 K194 R196 H198 M199 H200 R201 K202 R203

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6xu8, PDBe:6xu8, PDBj:6xu8
PDBsum	6xu8
PubMed	34283226
UniProt	O17445\|RL15_DROME Large ribosomal subunit protein eL15 (Gene Name=RpL15)

[Back to BioLiP]