Structure of PDB 4v9b Chain CN

Receptor sequence
>4v9bCN (length=119) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYA
AQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVD
DTPVPHNGCRPKKKFRKAS
3D structure
PDB4v9b Structural basis for potent inhibitory activity of the antibiotic tigecycline during protein synthesis.
ChainCN
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna CN Y20 H22 N26 N27 I29 T31 G37 N38 P39 W42 S44 G46 G52 S53 K55 R85 P113 V114 H116 N117 G118 C119 R120 P121 K122 K123 Y10 H12 N16 N17 I19 T21 G27 N28 P29 W32 S34 G36 G42 S43 K45 R75 P103 V104 H106 N107 G108 C109 R110 P111 K112 K113
BS02 MG CN N26 G52 N16 G42
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v9b, PDBe:4v9b, PDBj:4v9b
PDBsum4v9b
PubMed23431179
UniProtP80376|RS11_THET8 Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]