Structure of PDB 4v8e Chain CN

Receptor sequence
>4v8eCN (length=122) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MIQPQTYLEVADNTGARKIMCIRVLKGSNAKYATVGDVIVASVKEAIPRG
AVKEGDVVKAVVVRTKKEIKRPDGSAIRFDDNAAVIINNQLEPRGTRVFG
PVARELREKGFMKIVSLAPEVL
3D structure
PDB4v8e A new understanding of the decoding principle on the ribosome.
ChainCN
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna CN M1 Q5 T6 Y7 I22 R23 L25 S28 N29 A30 K31 Y32 V40 S42 K44 G55 V57 K66 K67 E68 K70 M1 Q5 T6 Y7 I22 R23 L25 S28 N29 A30 K31 Y32 V40 S42 K44 G55 V57 K66 K67 E68 K70
BS02 rna CN P48 R49 P48 R49
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v8e, PDBe:4v8e, PDBj:4v8e
PDBsum4v8e
PubMed22437501
UniProtQ5SHP8|RL14_THET8 Large ribosomal subunit protein uL14 (Gene Name=rplN)

[Back to BioLiP]