Structure of PDB 4v87 Chain CN

Receptor sequence

>4v87CN (length=119) Species: 300852 (Thermus thermophilus HB8)

KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYA
AQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVD
DTPVPHNGCRPKKKFRKAS

3D structure

• PDB: 4v87 A new understanding of the decoding principle on the ribosome.
• Chain: CN
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CN	Y20 H22 N26 N27 I29 T31 G37 N38 P39 W42 S44 G46 V47 G52 S53 K55 R85 V114 P115 H116 N117 G118 C119 R120 K122 K123 K124	Y10 H12 N16 N17 I19 T21 G27 N28 P29 W32 S34 G36 V37 G42 S43 K45 R75 V104 P105 H106 N107 G108 C109 R110 K112 K113 K114
BS02	MG	CN	N26 G52	N16 G42

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v87, PDBe:4v87, PDBj:4v87
• PDBsum: 4v87
• PubMed: 22437501
• UniProt: P80376|RS11_THET8 Small ribosomal subunit protein uS11 (Gene Name=rpsK)